PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_5BL_44A8BCF95.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family Dof
Protein Properties Length: 328aa    MW: 33970.6 Da    PI: 8.5591
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_5BL_44A8BCF95.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1244.7e-393291261
                 zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                           +e++++cprC+s ntkfCyynnys+sqPryfCkaCrryWt+GG+lrnvP+Ggg+rk k+s
  Traes_5BL_44A8BCF95.1 32 PEQKVECPRCKSGNTKFCYYNNYSMSQPRYFCKACRRYWTHGGSLRNVPIGGGCRKPKRS 91
                           7899*****************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-303090IPR003851Zinc finger, Dof-type
PfamPF027019.5E-333490IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.6493690IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103874IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 328 aa     Download sequence    Send to blast
MEEVFPSNSK SKAGQMAGEA TAAAEKKPRP KPEQKVECPR CKSGNTKFCY YNNYSMSQPR  60
YFCKACRRYW THGGSLRNVP IGGGCRKPKR SGTSDAHKLG VASSSEHTAV MPPSTCTGIN  120
FANVLPTFMS AGFEIPRSLS LTTFGSSSSS NTTAVMSPGG TTSFLDVLRG GTGGLLDGNL  180
GQNNGYYYGG SRSGIGMLMT PPAASFGIPG PMQQHGDLMV GGNGIGAATA SIFQGGTGEE  240
GDDGIGAMMG LQWQPHVGNG GGGGVVSGGV HHLGTGNNVT MGNNNINNNN NNGSHSDDNT  300
GGSSRDCYWI NNGGSNPWQS LLNSSSLM
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKX0581350.0KX058135.1 Triticum aestivum prolamin binding factor (Dof) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLW5FAJ70.0W5FAJ7_WHEAT; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14037367
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60200.12e-32TARGET OF MONOPTEROS 6
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]